📖 Lesson A1 Grammar📐 Grammar

❤️ Grammar A1-16: like / love / hate

The sixteenth material of the Fleydo A1 grammar series, written for learners of about seven to ten. It teaches one sorting question — is it a thing, or is it something you do? — and hangs the whole topic on it. Two pattern pictures open the material (I + like + pizza, I + like + swimming), then a pair of cards shows the two shapes side by side, then a table brings back the third-person s from the present simple: he, she and it say likes, loves, hates. A four-step feelings ladder runs from love with three hearts down to hate, and picks up don’t like and doesn’t like on the way. Practice is spread across five sets — six feelings items where the learner reads what somebody does and chooses the word, eight easy form items, a ten-card sorting task that trains the thing-or-action question, eight harder items inside short contexts, and a six-item test — plus a small -ing spelling table (play, read, swim, make) and six real errors to repair. Every answer explains itself in words simpler than the grammar being taught. Teacher notes give a 45-minute sequence, the two-column board move, what to do with a stuck learner, and why the “to swim” door should stay shut at this level.

🧒 Kids (6–10) schedule 20 min signal_cellular_alt Easy visibility 19
FREE

view_agenda Lesson Plan

  • Two pattern pictures: like + a thing, and like + an action with -ing
  • Four tap-to-hear sentences, each person with one thing and one action

translate Key Vocabulary

likelovehatedon’t likedoesn’t likeswimmingplayingreadingdrawingcookingtidyingfavouritedogsice cream

auto_fix_high Grammar Points

  • like / love / hate + a thing: I like pizza.
  • like / love / hate + verb + -ing: I like swimming.
  • he / she / it adds an s: She likes swimming.
  • Negative: I don’t like fish. He doesn’t like fish. (never “doesn’t likes”)
  • -ing spelling: play → playing, swim → swimming, make → making
  • All of them takes the -s word: I like dogs, not “I like dog”

arrow_upward Prerequisites

Junte-se às Nossas Aulas!

Acreditamos que as perguntas certas trazem as respostas certas. Se você tem alguma dúvida sobre sua jornada de aprendizado, estamos sempre aqui.

route O FleyPath

O roteiro pessoal do seu filho — 3, 6 ou 12 meses

🚀Início
👋Hello
😊Body
🦁Animals
🔢Numbers
🏆Inglês confiante
sports_esports Prática de inglês gamificada

Como um jogo — só que eles estão realmente aprendendo