📖 Lesson A1 Grammar📐 Grammar

❤️ Grammar A1-16: like / love / hate

The sixteenth material of the Fleydo A1 grammar series, written for learners of about seven to ten. It teaches one sorting question — is it a thing, or is it something you do? — and hangs the whole topic on it. Two pattern pictures open the material (I + like + pizza, I + like + swimming), then a pair of cards shows the two shapes side by side, then a table brings back the third-person s from the present simple: he, she and it say likes, loves, hates. A four-step feelings ladder runs from love with three hearts down to hate, and picks up don’t like and doesn’t like on the way. Practice is spread across five sets — six feelings items where the learner reads what somebody does and chooses the word, eight easy form items, a ten-card sorting task that trains the thing-or-action question, eight harder items inside short contexts, and a six-item test — plus a small -ing spelling table (play, read, swim, make) and six real errors to repair. Every answer explains itself in words simpler than the grammar being taught. Teacher notes give a 45-minute sequence, the two-column board move, what to do with a stuck learner, and why the “to swim” door should stay shut at this level.

🧒 Kids (6–10) schedule 20 min signal_cellular_alt Easy
FREE

view_agenda Lesson Plan

  • Two pattern pictures: like + a thing, and like + an action with -ing
  • Four tap-to-hear sentences, each person with one thing and one action

translate Key Vocabulary

likelovehatedon’t likedoesn’t likeswimmingplayingreadingdrawingcookingtidyingfavouritedogsice cream

auto_fix_high Grammar Points

  • like / love / hate + a thing: I like pizza.
  • like / love / hate + verb + -ing: I like swimming.
  • he / she / it adds an s: She likes swimming.
  • Negative: I don’t like fish. He doesn’t like fish. (never “doesn’t likes”)
  • -ing spelling: play → playing, swim → swimming, make → making
  • All of them takes the -s word: I like dogs, not “I like dog”

arrow_upward Prerequisites

Treten Sie unseren Klassen bei!

Wir glauben, dass die richtigen Fragen die richtigen Antworten bringen. Wir sind immer für Sie da.

route Der FleyPath

Der persönliche Fahrplan deines Kindes — 3, 6 oder 12 Monate

🚀Start
👋Hello
😊Body
🦁Animals
🔢Numbers
🏆Sicheres Englisch
sports_esports Gamifiziertes Englisch-Üben

Wie ein Spiel — nur dass sie wirklich lernen