📖 Lesson A1 Grammar📐 Grammar

🐾 Grammar A1-6: Nouns: singular and plural

The plural material of the Fleydo A1 grammar series, written for learners of about seven to ten. It builds the plural from sound outwards: first the picture of dog + s = dogs, then a four-row table of the spelling groups — plain -s, es after a hissy or shushy ending (s, x, ch, sh), a letter + y turning into ies, and f or fe turning into ves — with the y trap spelled out in full (boys, days, keys against babies, cities, stories). Ten tap-and-repeat cards let learners hear the extra bit at the end of bus-es and box-es before they ever write it. Practice is spread across four blocks: eight easy one-word items, a ten-word sorting task that separates -s from -es by ear, eight harder items inside real sentences, and six unhinted test items with a scored result. A whole section is given to the nine odd words a child meets every week — man, woman, child, foot, tooth, mouse, person, fish, sheep — as a table plus a picture set, because they are vocabulary and not a rule. Every answer explains itself in language simpler than the grammar being taught. Teacher notes give a 45-minute sequence, the four-column board move, the say-it-before-you-spell-it rule and the follow-up topics.

🧒 Kids (6–10) schedule 20 min signal_cellular_alt Easy visibility 9
FREE

view_agenda Lesson Plan

  • The plural as a picture: dog + s = dogs
  • Four tap-to-hear model sentences, one from each group

translate Key Vocabulary

dogsbusesboxessandwichesdishesbabiesstorieskeysleaveskniveschildrenfeetteethpeople

auto_fix_high Grammar Points

  • Most nouns just take a small s: one dog, two dogs
  • Words ending in s, x, ch or sh take es: box → boxes, watch → watches
  • A letter + y becomes ies: baby → babies — but a, e, o, u + y only takes s: boys, keys
  • Words ending in f or fe become ves: leaf → leaves, knife → knives
  • Odd ones to learn by heart: man–men, woman–women, child–children, foot–feet, tooth–teeth, mouse–mice, person–people
  • Fish and sheep never change, and a / an never sits next to a plural

arrow_upward Prerequisites

আমাদের ক্লাসে যোগ দিন!

আমরা বিশ্বাস করি সঠিক প্রশ্ন সঠিক উত্তর নিয়ে আসে। আপনার ইংরেজি শেখার যাত্রা সম্পর্কে কোনো প্রশ্ন থাকলে, আমরা সবসময় এখানে আছি।

route FleyPath

আপনার সন্তানের ব্যক্তিগত রোডম্যাপ — ৩, ৬ বা ১২ মাস

🚀শুরু
👋Hello
😊Body
🦁Animals
🔢Numbers
🏆আত্মবিশ্বাসী ইংরেজি
sports_esports গেমিফায়েড ইংরেজি অনুশীলন

একটি গেমের মতো — কিন্তু তারা সত্যিই শিখছে